SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283806705|ref|NP_001164608.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283806705|ref|NP_001164608.1|
Domain Number 1 Region: 491-562
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.81e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00028
Further Details:      
 
Domain Number 2 Region: 371-441
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.48e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283806705|ref|NP_001164608.1|
Sequence length 658
Comment spermatid perinuclear RNA-binding protein isoform 2 [Homo sapiens]
Sequence
MVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEGETEVKKDEAGENYS
KDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQKLTE
EKYQVEQCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLLDRQK
CLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTC
NRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTIQQKEDITHSAQHAL
RLSAFGQIYKVLEMDPLPSSKPFQKYSWSVTDKEGAGSSALKRPFEDGLGDDKDPNKKMK
RNLRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGP
SKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNSSNNTGNSTTET
SSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFRG
AGPNKKVAKASAALAALEKLFSGPNAANNKKKKIIPQAKGVVNTAVSAAVQAVRGRGRGT
LTRGAFVGATAAPGYIAPGYGTPYGYSTAAPAYGLPKRMVLLPVMKFPTYPVPHYSFF
Download sequence
Identical sequences A0A2J8NC72 A0A2J8SFI5 A0A2K5QT21 A0A2K5TVU3 A0A2K6AG53 A0A2K6EA93
NP_001164608.1.87134 NP_001164608.1.92137 XP_005580877.1.63531 XP_009000926.1.60252 XP_011709607.1.29376 XP_011820888.1.47321 XP_017403857.1.71028 XP_017831493.1.60252 XP_017831505.1.60252 ENSP00000354271 ENSP00000354271 gi|283806705|ref|NP_001164608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]