SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284005537|ref|NP_001164638.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284005537|ref|NP_001164638.1|
Domain Number 1 Region: 557-638
Classification Level Classification E-value
Superfamily E set domains 4.2e-19
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000041
Further Details:      
 
Domain Number 2 Region: 733-833
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000115
Family Ankyrin repeat 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|284005537|ref|NP_001164638.1|
Domain Number - Region: 1113-1164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000876
Family Motor proteins 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284005537|ref|NP_001164638.1|
Sequence length 1241
Comment calmodulin-binding transcription activator 2 isoform 4 [Homo sapiens]
Sequence
MGTDSPSPRPLRPGVTLPPGALTMNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPE
RLRWNTNEEIASYLITFEKHDEWLSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDG
KTTREDHMKLKVQGMECLYGCYVHSSIVPTFHRRCYWLLQNPDIVLVHYLNVPALEDCGK
GCSPIFCSISSDRREWLKWSREELLGQLKPMFHGIKWSCGNGTEEFSVEHLVQQILDTHP
TKPAPRTHACLCSGGLGSGSLTHKCSSTKHRIISPKVEPRALTLTSIPHAHPPEPPPLIA
PLPPELPKAHTSPSSSSSSSSSGFAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQRAGG
LTPTRHLAPQADPRPSMSLAVVVGTEPSAPPAPPSPAFDPDRFLNSPQRGQTYGGGQGVS
PDFPEAEAAHTPCSALEPAAALEPQAAARGPPPQSVAGGRRGNCFFIQDDDSGEELKGHG
AAPPIPSPPPSPPPSPAPLEPSSRVGRGEALFGGPVGASELEPFSLSSFPDLMGELISDE
APSIPAPTPQLSPALSTITDFSPEWSYPEGGVKVLITGPWTEAAEHYSCVFDHIAVPASL
VQPGVLRCYCPAHEVGLVSLQVAGREGPLSASVLFEYRARRFLSLPSTQLDWLSLDDNQF
RMSILERLEQMEKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTW
KGPERLAHGSPFRGMSLLHLAAAQGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSC
TPLMWACALGHLEAAVLLFRWNRQALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQEP
SVEPPFALSPPSSSPDTGLSSVSSPSELSDGTFSVTSAYSSAPDGSPPPAPLPASEMTME
DMAPGQLSSGVPEAPLLLMDYEATNSKGPLSSLPALPPASDDGAAPEDADSPQAVDVIPV
DMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPS
STPPSELPFERGRLAVPSAPSWAEFLSASTSGKMESDFALLTLSDHEQRELYEAARVIQT
AFRKYKGRRLKEQQEVAAAVIQRCYRKYKQLTWIALKFALYKKMTQAAILIQSKFRSYYE
QKRFQQSRRAAVLIQQHYRSYRRRPGPPHRTSATLPARNKLLSHQEAGPGSPEDHEIPAA
LPTQDEGTEAEPGAGRASPAGTGHMTWPPPFSPPWGRLVQS
Download sequence
Identical sequences gi|284005537|ref|NP_001164638.1| NP_001164638.1.87134 NP_001164638.1.92137 ENSP00000412886 ENSP00000412886 ENSP00000412886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]