SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28416436|ref|NP_783202.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28416436|ref|NP_783202.1|
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.1e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28416436|ref|NP_783202.1|
Sequence length 414
Comment ADP-ribosylation factor GTPase-activating protein 1 isoform b [Homo sapiens]
Sequence
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKF
WGHKQQPEPASELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKGVGSKGWRDVTT
FFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCA
DTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW
Download sequence
Identical sequences ENSP00000314615 ENSP00000359298 ENSP00000314615 gi|28416436|ref|NP_783202.1| NP_783202.1.87134 NP_783202.1.92137 9606.ENSP00000314615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]