SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284413734|ref|NP_653309.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284413734|ref|NP_653309.3|
Domain Number 1 Region: 285-307,335-362,702-1064
Classification Level Classification E-value
Superfamily ARM repeat 2.07e-54
Family Armadillo repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 505-695
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.39e-29
Family Ankyrin repeat 0.00055
Further Details:      
 
Domain Number 3 Region: 996-1293
Classification Level Classification E-value
Superfamily ARM repeat 1.41e-22
Family Armadillo repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284413734|ref|NP_653309.3|
Sequence length 1434
Comment ankyrin and armadillo repeat-containing protein [Homo sapiens]
Sequence
MLRLPKKGLPRFEQVQDEDTYLENLAIQRNASAFFEKYDRSEIQELLTTALVSWLSAKED
VRSQVDLPCGIMSQMNNVGFSTAILLTPVDPTALLDYREVHQMIRELAIGIYCLNQIPSI
SLEANYDQSSSCQLPPAYYDTRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMD
IDPDGKPQTNKDIFSEFSSAGLTDITKDPDFNEIYDEDVNEDPTYDPNSPEETAVFMKYA
ENIMLKLTFSTTQIQQYENVFIFETGYWLTNAIKYNQDYLDICTYQRLQQRLYLQKKIIQ
KHFEKKKDIRRGIGYLKLICFLIPFLLSLKKKMKVPYLSSLLQPFSDDKVKTERELPPFI
YGRDFKCQNFHYKENQYFHVHGGIEFDISTPSIENALEDFQKNLEKIRDCAANTFIEDSG
YKEYYSIPVMEFHGKSYYVIYFELETFYQQLYKTQWWGAINEIVNNLRLKRLPLTDAQLH
EQFKKKLGFKRAMKCKSIPFGMKSAVERGLSAVFHTFSRKTSSSTINVSDEAGYTIFHHA
ALHNRVSIICQLCNANFKVNQRRFVTFSQGPTPLHLAAQACSLETTVCLLCSKADYTLSE
KRGWMPIHFAAFYDNVCIIIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFS
IGANWRKTDIKGNNIIHLSVLTFHTEVLKYIIKLNIPELPVWKTLVEMLQCESYKRRMMA
VMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQCKTVGLLSNISTHKSAVHALV
EAGGIPSLINLLVCDEPEVHSRCAVILYDIAQCENKDVIAKYNGIPSLINLLNLNIENVL
VNVMNCIRVLCIGNENNQRAVREHKGLPYLIRFLSSDSDVLKAVSSAAIAEVGRDNKEIQ
DAIAMEGAIPPLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTKYLLKLLKA
FQIDVKEQGAVALWALAGQTLKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSK
DSRMHQNQICEGNGIAPLVRLLRISTIAEGTLLSVIRAVGSICIGVAHTSNPVSQQLVVD
ENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGNDVLQKDLHENEGFEYADVLYLLHSTE
KDICLRAGYALTLFAFNNRFQQYLILESGIMTISIFERFLESTVETEKAMAAFQIVVLAK
VIRDMDHITLSARGVTILVDSLYSVQTSTIVLTGNLIASLAHSRAGIPEAFTTLGTIQRL
CYHLYSGIEEVRAACSSALGYLTYNANAFRILLKECRNKPNQFIRIKNNISRDASINPAF
LKEFQMQQTLVGLPSLSLEKNGGPSIIPIFKRGKEHRRKLKPKIQPKDSLTLLPPVTNFM
GLFKATKKTKDSHNIFSFSSTITSDITNVSRPRIVCLNQLGKHVQKANPEPAEG
Download sequence
Identical sequences Q7Z5J8
ENSP00000397243 gi|284413734|ref|NP_653309.3| ENSP00000313513 ENSP00000427882 ENSP00000313513 ENSP00000427882 NP_653309.3.87134 NP_653309.3.92137 XP_011508976.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]