SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284807142|ref|NP_076987.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284807142|ref|NP_076987.3|
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily GLA-domain 1.43e-21
Family GLA-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284807142|ref|NP_076987.3|
Sequence length 231
Comment transmembrane gamma-carboxyglutamic acid protein 3 precursor [Homo sapiens]
Sequence
MAVFLEAKDAHSVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEFW
KGYPNAVYSVRDPSQSSDAMYVVVPLLGVALLIVIALFIIWRCQLQKATRHHPSYAQNRY
LASRAGHTLPRVMVYRGTVHSQGEPSGHREAANSPQVVLGPSRGGRTTVRLESTLYLPEL
SLSRLSSTTPPPSYEEVTAPQESSSEEASVSYSDPPPKYEEIVAANPGADK
Download sequence
Identical sequences Q9BZD7
ENSP00000359378 ENSP00000440217 ENSP00000359378 ENSP00000440217 gi|284807142|ref|NP_076987.3| 9606.ENSP00000359378 NP_076987.3.87134 NP_076987.3.92137 XP_005274804.1.92137 XP_011529499.1.92137 ENSP00000394121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]