SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28559029|ref|NP_783854.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28559029|ref|NP_783854.1|
Domain Number 1 Region: 126-225
Classification Level Classification E-value
Superfamily Fibronectin type III 1.6e-17
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 2 Region: 239-331
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000317
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  gi|28559029|ref|NP_783854.1|
Domain Number - Region: 32-86
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00173
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28559029|ref|NP_783854.1|
Sequence length 333
Comment interleukin-5 receptor subunit alpha isoform 2 precursor [Homo sapiens]
Sequence
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGK
Download sequence
Identical sequences NP_783851.1.87134 NP_783851.1.92137 NP_783854.1.87134 NP_783854.1.92137 gi|28559023|ref|NP_783851.1| gi|28559029|ref|NP_783854.1| ENSP00000392059 ENSP00000400400 Q15469 ENSP00000392059 ENSP00000400400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]