SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28605137|ref|NP_736606.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28605137|ref|NP_736606.1|
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-40
Family Ankyrin repeat 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28605137|ref|NP_736606.1|
Sequence length 151
Comment 26S proteasome non-ATPase regulatory subunit 10 isoform 2 [Homo sapiens]
Sequence
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLLEGGANPDAKDHYEATAMHRAAAKDT
Download sequence
Identical sequences A0A2J8J2J0 A0A2J8VAP2
NP_736606.1.87134 NP_736606.1.92137 XP_002832023.1.23681 XP_003262227.1.23891 XP_003317666.1.37143 XP_003819734.1.60992 XP_004064739.1.27298 XP_004861506.1.39548 XP_005323427.1.77405 XP_006142891.1.99106 XP_015353416.1.40921 gi|28605137|ref|NP_736606.1| ENSP00000354906 ENSP00000354906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]