SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28626517|ref|NP_056383.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28626517|ref|NP_056383.1|
Domain Number 1 Region: 64-308
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.44e-61
Family Ankyrin repeat 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28626517|ref|NP_056383.1|
Sequence length 567
Comment protein phosphatase 1 regulatory inhibitor subunit 16B isoform 1 [Homo sapiens]
Sequence
MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR
RKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLL
LSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTL
DVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANG
YLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPID
LCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRASLSDRTNLYRK
EYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGEL
DMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTL
LELKRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVT
SGDPPLLKFKAPIEEMEEKVHGCCRIS
Download sequence
Identical sequences Q96T49
ENSP00000299824 NP_056383.1.87134 NP_056383.1.92137 ENSP00000299824 9606.ENSP00000299824 gi|28626517|ref|NP_056383.1| ENSP00000299824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]