SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28882043|ref|NP_795361.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28882043|ref|NP_795361.1|
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.84e-23
Family APC10-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28882043|ref|NP_795361.1|
Sequence length 139
Comment nuclear receptor 2C2-associated protein [Homo sapiens]
Sequence
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVS
QLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDA
TDFFGRVVIYHLRVLGEKV
Download sequence
Identical sequences Q86WQ0
gi|28882043|ref|NP_795361.1| GO.35114 ENSP00000332823 NP_795361.1.87134 NP_795361.1.92137 ENSNLEP00000007543 9606.ENSP00000332823 ENSP00000332823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]