SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288915529|ref|NP_001165889.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288915529|ref|NP_001165889.1|
Domain Number 1 Region: 411-516
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000709
Family Galactose-binding domain 0.08
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily POZ domain 0.000000000589
Family BTB/POZ domain 0.036
Further Details:      
 
Domain Number 3 Region: 229-304,333-373
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000319
Family APC10-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288915529|ref|NP_001165889.1|
Sequence length 582
Comment BTB/POZ domain-containing protein 9 isoform c [Homo sapiens]
Sequence
MCRALLYGGMRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHK
YGFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFL
SLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVV
RPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGD
TQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELD
WVRVIDHSQYLCRSWQKLYFPARVCSGDGVSLWCPLWSRTPELKQSSLLGLPKCRYIRIV
GTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEGVSRSRNALLNG
DTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWT
MVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFECPEQQSSQKEENSEE
SGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPNRQHQ
Download sequence
Identical sequences A0A2I2ZE82 A0A2I3RA02
NP_001165889.1.87134 NP_001165889.1.92137 ENSP00000415365 ENSP00000415365 gi|288915529|ref|NP_001165889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]