SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289546503|ref|NP_001166038.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289546503|ref|NP_001166038.1|
Domain Number 1 Region: 20-135
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-26
Family DEATH domain, DD 0.0034
Further Details:      
 
Domain Number 2 Region: 173-315
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-26
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289546503|ref|NP_001166038.1|
Sequence length 317
Comment myeloid differentiation primary response protein MyD88 isoform 1 [Homo sapiens]
Sequence
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRLARRPRGGCRRM
VVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNP
CTKSWFWTRLAKALSLP
Download sequence
Identical sequences A0A0A0MST0
ENSP00000401399 ENSP00000401399 NP_001166038.1.87134 NP_001166038.1.92137 gi|289546503|ref|NP_001166038.1| ENSP00000417848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]