SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28973785|ref|NP_004109.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28973785|ref|NP_004109.1|
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-40
Family Forkhead DNA-binding domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28973785|ref|NP_004109.1|
Sequence length 330
Comment forkhead box protein S1 [Homo sapiens]
Sequence
MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRP
GWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGA
EGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPA
TTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSP
ESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWV
AGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
Download sequence
Identical sequences O43638
9606.ENSP00000365145 ENSP00000365145 gi|28973785|ref|NP_004109.1| ENSP00000365145 ENSP00000365145 NP_004109.1.87134 NP_004109.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]