SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291045183|ref|NP_001166945.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291045183|ref|NP_001166945.1|
Domain Number 1 Region: 12-194
Classification Level Classification E-value
Superfamily ITPase-like 1.24e-46
Family Maf-like 0.0000252
Further Details:      
 
Domain Number 2 Region: 353-594
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.95e-46
Family Plant O-methyltransferase, C-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 271-346
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000804
Family Plant O-methyltransferase, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291045183|ref|NP_001166945.1|
Sequence length 605
Comment N-acetylserotonin O-methyltransferase-like protein isoform 3 [Homo sapiens]
Sequence
MVLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKASFATPYGYAME
TAKQKALEVANRLYQTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQ
LDTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNV
VGFPLNHFCKQLVKLYYPPRPEDLRRSVKHDSIPAADTFEDLSDVEGGGSEPTQRDAGSR
DEKAEAGEAGQATAEAECHRTRETLPPFPTRLLELIEGFMLSKGLLTACKLKVFDLLKDE
APQKAADIASKVDASACGMERLLDICAAMGLLEKTEQGYSNTETANVYLASDGEYSLHGF
IMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQDAYYQSPETRLRFMRAMHGMT
KLTACQVATAFNLSRFSSACDVGGCTGALARELAREYPRMQVTVFDLPDIIELAAHFQPP
GPQAVQIHFAAGDFFRDPLPSAELYVLCRILHDWPDDKVHKLLSRVAESCKPGAGLLLVE
TLLDEEKRVAQRALMQSLNMLVQTEGKERSLGEYQCLLELHGFHQVQVVHLGGVLDAILA
TKVAP
Download sequence
Identical sequences ENSP00000370734 ENSP00000370734 NP_001166945.1.87134 NP_001166945.1.92137 gi|291045183|ref|NP_001166945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]