SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291167777|ref|NP_001167023.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291167777|ref|NP_001167023.1|
Domain Number 1 Region: 152-394
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-85
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 61-160
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-16
Family Hepsin, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 16-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291167777|ref|NP_001167023.1|
Sequence length 397
Comment transmembrane protease serine 4 isoform 5 [Homo sapiens]
Sequence
MDPDSDQPLNSLVKVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGP
AVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQ
DLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQV
SIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIE
FNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMS
DILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHV
VGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Download sequence
Identical sequences NP_001167023.1.87134 NP_001167023.1.92137 gi|291167777|ref|NP_001167023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]