SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291327513|ref|NP_001167540.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291327513|ref|NP_001167540.1|
Domain Number 1 Region: 187-253
Classification Level Classification E-value
Superfamily Homeodomain-like 1.58e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 61-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000218
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000153
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|291327513|ref|NP_001167540.1|
Domain Number - Region: 122-150
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.057
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291327513|ref|NP_001167540.1|
Sequence length 382
Comment LIM homeobox transcription factor 1-alpha [Homo sapiens]
Sequence
MLDGLKMEENFQSAIDTSASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCV
QCASCKEPLETTCFYRDKKLYCKYDYEKLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCF
CCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHG
AGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQ
VWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLL
AIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGP
LQSRVGNPIDHLYSMQNSYFTS
Download sequence
Identical sequences A0A096NWR5 A0A2J8SL32 A0A2K5JUA3 A0A2K5KHP5 A0A2K5Q8W3 A0A2K5ZET9 A0A2K6BHU9 A0A2K6L2Q3 A0A2K6NQS3 F7B132 F7HWH3 G3QL82 G7NU26 H2Q0I2 Q8TE12
ENSPTRP00000002699 NP_001167540.1.87134 NP_001167540.1.92137 NP_796372.1.87134 NP_796372.1.92137 XP_003824628.1.60992 XP_003824629.1.60992 XP_004027869.1.27298 XP_004027870.1.27298 XP_007987892.1.81039 XP_007987893.1.81039 XP_007987894.1.81039 XP_008983361.1.60252 XP_010371663.1.97406 XP_010371664.1.97406 XP_011758648.1.29376 XP_011758649.1.29376 XP_011788743.1.43180 XP_011788744.1.43180 XP_011853520.1.47321 XP_011853521.1.47321 XP_011942773.1.92194 XP_011942774.1.92194 XP_014981045.1.72884 XP_015300036.1.63531 XP_017741910.1.44346 ENSPANP00000017497 ENSMMUP00000008291 ENSGGOP00000003228 ENSP00000294816 ENSP00000340226 ENSP00000356868 ENSMMUP00000008291 ENSMMUP00000037754 ENSP00000294816 ENSP00000340226 ENSP00000356868 ENSP00000294816 gi|28893581|ref|NP_796372.1| gi|291327513|ref|NP_001167540.1| 9544.ENSMMUP00000008291 9598.ENSPTRP00000002699 9606.ENSP00000294816 ENSCJAP00000008539 ENSGGOP00000003228 ENSCJAP00000008539 ENSPTRP00000002699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]