SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29244926|ref|NP_006578.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29244926|ref|NP_006578.2|
Domain Number 1 Region: 787-1034
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-77
Family Eukaryotic proteases 0.0000652
Further Details:      
 
Domain Number 2 Region: 453-574
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.57e-35
Family Frizzled cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 3 Region: 137-249
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-30
Family Frizzled cysteine-rich domain 0.00065
Further Details:      
 
Domain Number 4 Region: 654-698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 579-616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 6 Region: 342-380
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 306-342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 383-424
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 269-306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 620-652
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 11 Region: 711-790
Classification Level Classification E-value
Superfamily SRCR-like 0.000034
Family Scavenger receptor cysteine-rich (SRCR) domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29244926|ref|NP_006578.2|
Sequence length 1042
Comment atrial natriuretic peptide-converting enzyme [Homo sapiens]
Sequence
MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVL
LLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVSTAHPDQHVPA
WTTDASLPGDQSHRNTSACMNITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLHR
LSCYQHIMLFGCTLAFPECIIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLRC
SQFRNQTESSNVSRICFSPQQENGKQLLCGRGENFLCASGICIPGKLQCNGYNDCDDWSD
EAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCIAMEW
VCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTS
CQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHR
TQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERC
ESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCD
GQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDEL
ECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQE
ILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSK
ISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLT
VAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSE
DISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFD
MKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVY
SNVSYFVEWIKRQIYIQTFLLN
Download sequence
Identical sequences Q9Y5Q5
ENSP00000273857 NP_006578.2.87134 NP_006578.2.92137 gi|29244926|ref|NP_006578.2| NYSGRC-29244926 9606.ENSP00000273857 ENSP00000273857 ENSP00000273857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]