SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29366833|ref|NP_808880.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29366833|ref|NP_808880.1|
Domain Number - Region: 145-205
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.051
Family Allantoicase repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29366833|ref|NP_808880.1|
Sequence length 207
Comment hypothetical protein LOC157657 [Homo sapiens]
Sequence
MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKE
DDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGT
NISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYA
CQCSWRTIEEVTDLQTDHQLRWVCGKH
Download sequence
Identical sequences Q96NL8
ENSP00000286688 gi|29366833|ref|NP_808880.1| NP_808880.1.87134 NP_808880.1.92137 9606.ENSP00000286688 ENSP00000286688 ENSP00000286688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]