SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294337038|ref|NP_001135932.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294337038|ref|NP_001135932.2|
Domain Number 1 Region: 59-358
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.77e-57
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 378-422
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000327
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294337038|ref|NP_001135932.2|
Sequence length 429
Comment ankyrin repeat and SOCS box protein 10 isoform 2 [Homo sapiens]
Sequence
MLMSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQ
AVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLWSLTYEEELTTPL
HVAASRGHTEVLRLLLRRRARPDSAPGGRTALHEACAAGHTACVHVLLVAGADPNIADQD
GKRPLHLCRGPGTLECAELLLRFGARVDGRSEEEEETPLHVAARLGHVELADLLLRRGAC
PDARNAEGWTPLLAACDVRCQSITDAEATTARCLQLCSLLLSAGADADAADQDKQRPLHL
ACRRGHAAVVELLLSCGVSANTMDYGGHTPLHCALQGPAAALAQSPEHVVRALLNHGAVR
VWPGALPKKHQRFYSSLFALVRQPRSLQHLSRCALRSHLEGSLPQALPRLPLPPRLLRYL
QLDFEGVLY
Download sequence
Identical sequences A0A090N8I2
gi|294337038|ref|NP_001135932.2| ENSP00000275838 ENSP00000275838 NP_001135932.2.87134 NP_001135932.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]