SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295424145|ref|NP_001171347.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295424145|ref|NP_001171347.1|
Domain Number 1 Region: 144-289
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-41
Family Proprotein convertase P-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 2-143
Classification Level Classification E-value
Superfamily Subtilisin-like 3.93e-27
Family Subtilases 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295424145|ref|NP_001171347.1|
Sequence length 443
Comment neuroendocrine convertase 1 isoform 3 [Homo sapiens]
Sequence
MLDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQTSADL
HNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNPGWKKNG
AGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIP
TRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKN
WDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEHMKQPRVYTSY
NTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKSPSSSSVGGRRDELEEGAPSQAMLRL
LQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYN
TKPYKHRDDRLLQALVDILNEEN
Download sequence
Identical sequences gi|295424145|ref|NP_001171347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]