SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295844834|ref|NP_060037.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295844834|ref|NP_060037.3|
Domain Number 1 Region: 164-389
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.27e-62
Family BadF/BadG/BcrA/BcrD-like 0.000000000946
Further Details:      
 
Domain Number 2 Region: 48-161
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.17e-24
Family BadF/BadG/BcrA/BcrD-like 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295844834|ref|NP_060037.3|
Sequence length 390
Comment N-acetyl-D-glucosamine kinase [Homo sapiens]
Sequence
MRTRTGSQLAAREVTGSGAVPRQLEGRRCQAGRDANGGTSSDGSSSMAAIYGGVEGGGTR
SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLS
LSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLI
NPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQV
PDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEID
PVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALG
GASLGARHIGHLLPMDYSANAIAFYSYTFS
Download sequence
Identical sequences ENSP00000389087 ENSP00000389087 ENSP00000477639 NP_060037.3.87134 NP_060037.3.92137 ENSP00000389087 gi|295844834|ref|NP_060037.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]