SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29826299|ref|NP_816931.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29826299|ref|NP_816931.1|
Domain Number 1 Region: 14-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-45
Family G proteins 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29826299|ref|NP_816931.1|
Sequence length 186
Comment ADP-ribosylation factor-like protein 6 [Homo sapiens]
Sequence
MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKS
SSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKH
RRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQ
IQTVKT
Download sequence
Identical sequences A0A2I2Z0Q8 A0A2I3FYK6 A0A2I3RPA7 Q9H0F7
ENSP00000337722 ENSP00000377756 ENSP00000418057 ENSP00000419619 ENSPTRP00000026133 ENSPTRP00000026133 gi|14149815|ref|NP_115522.1| gi|29826299|ref|NP_816931.1| NP_001265222.1.87134 NP_001265222.1.92137 NP_115522.1.87134 NP_115522.1.92137 NP_816931.1.87134 NP_816931.1.92137 XP_001139103.1.37143 XP_001139194.1.37143 XP_001139431.1.37143 XP_003261746.1.23891 XP_003261747.1.23891 XP_003261748.1.23891 XP_003821932.1.60992 XP_003821933.1.60992 XP_003821934.1.60992 XP_016862800.1.92137 XP_018880405.1.27298 XP_018880406.1.27298 XP_018880407.1.27298 ENSNLEP00000002422 ENSNLEP00000002422 GO.42695 hsi002010608.1 9598.ENSPTRP00000026133 9606.ENSP00000337722 ENSP00000337722 ENSP00000337722 ENSP00000377756 ENSP00000418057 ENSP00000419619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]