SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298566315|ref|NP_001177313.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298566315|ref|NP_001177313.1|
Domain Number 1 Region: 299-607
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.17e-57
Family ROK 0.0014
Further Details:      
 
Domain Number 2 Region: 4-277
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.9e-57
Family UDP-N-acetylglucosamine 2-epimerase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298566315|ref|NP_001177313.1|
Sequence length 612
Comment bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase isoform 5 [Homo sapiens]
Sequence
MIEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALAL
ATSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRIL
LAGCPSYDKLLSAKNKDYMSIIRMWLGSKEMVRVMRKKGIEHHPNFRAVKHVPFDQFIQL
VAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQ
FGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSAL
AVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRILGV
GISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAALAERKFGQ
GKGLENFVTLITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAY
ASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALG
LGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAA
SMVLDYTTRRIY
Download sequence
Identical sequences A0A2I2Z1T9 A0A2I3SV53 A0A2J8T097 A0A2K5ECK9 A0A2K5S4H3 A0A2K6FTD3 A0A2K6TN33
NP_001177313.1.87134 NP_001177313.1.92137 XP_008953508.1.60992 ENSP00000445117 gi|298566315|ref|NP_001177313.1| ENSP00000445117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]