SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29893808|ref|NP_536356.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29893808|ref|NP_536356.3|
Domain Number 1 Region: 152-377
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.92e-72
Family Actin/HSP70 0.000000762
Further Details:      
 
Domain Number 2 Region: 8-157
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.49e-49
Family Actin/HSP70 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29893808|ref|NP_536356.3|
Sequence length 377
Comment actin-related protein T2 [Homo sapiens]
Sequence
MFNPHALDSPAVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGE
EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR
EKMAEVMFENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVT
KLHVAGRDITELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELSRRPEEVLR
EYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIV
LSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT
AADFKEFGTSVVQRRCF
Download sequence
Identical sequences Q8TDY3
9606.ENSP00000367658 gi|29893808|ref|NP_536356.3| NP_536356.3.87134 NP_536356.3.92137 ENSP00000367658 ENSP00000367658 ENSP00000367658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]