SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|299523015|ref|NP_001177411.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|299523015|ref|NP_001177411.1|
Domain Number 1 Region: 124-454
Classification Level Classification E-value
Superfamily Subtilisin-like 5.24e-91
Family Subtilases 0.000000000969
Further Details:      
 
Domain Number 2 Region: 453-603
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-43
Family Proprotein convertase P-domain 0.0000886
Further Details:      
 
Domain Number 3 Region: 1468-1624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.11e-31
Family Growth factor receptor domain 0.00056
Further Details:      
 
Domain Number 4 Region: 833-996
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.89e-30
Family Growth factor receptor domain 0.00067
Further Details:      
 
Domain Number 5 Region: 634-792
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.44e-28
Family Growth factor receptor domain 0.00017
Further Details:      
 
Domain Number 6 Region: 1274-1430
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.24e-27
Family Growth factor receptor domain 0.00077
Further Details:      
 
Domain Number 7 Region: 982-1140
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.82e-27
Family Growth factor receptor domain 0.00092
Further Details:      
 
Domain Number 8 Region: 1126-1289
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.37e-26
Family Growth factor receptor domain 0.00062
Further Details:      
 
Domain Number 9 Region: 35-107
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 6.97e-24
Family Prohormone convertase 1 pro-domain 0.0022
Further Details:      
 
Domain Number 10 Region: 1566-1727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.39e-21
Family Growth factor receptor domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|299523015|ref|NP_001177411.1|
Sequence length 1860
Comment proprotein convertase subtilisin/kexin type 5 isoform 1 preproprotein [Homo sapiens]
Sequence
MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFI
NIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSR
AQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPD
LMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIG
GVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGR
RGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYS
SGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIR
PNSAVRSIYKASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANR
LFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSV
QPYSPTNEFPKVERFRYSRVEDPTDDYGTEDYAGPCDPECSEVGCDGPGPDHCNDCLHYY
YKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSHGDQCMSCKYGYFLNEETNSC
VTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVSCEDGRYFNGQ
DCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQTCEASCAKCQGPTQ
EDCTTCPMTRIFDDGRCVSNCPSWKFEFENQCHPCHHTCQRCQGSGPTHCTSCGADNYGR
EHFLYQGECGDSCPEGHYATEGNTCLPCPDNCELCHSVHVCTRCMKGYFIAPTNHTCQKL
ECGQGEVQDPDYEECVPCEEGCLGCSLDDPGTCTSCAMGYYRFDHHCYKTCPEKTYSEEV
ECKACDSNCGSCDQNGCYWCEEGFFLLGGSCVRKCGPGFYGDQEMGECESCHRACETCTG
PGHDECSSCQEGLQLLRGMCVHATKTQEEGKFWNDILRKLQPCHSSCKTCNGSATLCTSC
PKGAYLLAQACVSSCPQGTWPSVRSGSCENCTEACAICSGADLCKKCQMQPGHPLFLHEG
RCYSKCPEGSYAEDGICERCSSPCRTCEGNATNCHSCEGGHVLHHGVCQENCPERHVAVK
GVCKHCPEMCQDCIHEKTCKECTPEFFLHDDMCHQSCPRGFYADSRHCVPCHKDCLECSG
PKADDCELCLESSWVLYDGLCLEECPAGTYYEKETKECRDCHKSCLTCSSSGTCTTCQKG
LIMNPRGSCMANEKCSPSEYWDEDAPGCKPCHVKCFHCMGPAEDQCQTCPMNSLLLNTTC
VKDCPEGYYADEDSNRCAHCHSSCRTCEGRHSRQCHSCRPGWFQLGKECLLQCREGYYAD
NSTGRCERCNRSCKGCQGPRPTDCLSCDRFFFLLRSKGECHRSCPDHYYVEQSTQTCERC
HPTCDQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKG
PGAKNCTLCPANLVLHMDDSHCLHCCNTSDPPSAQECCDCQDTTDECILRTSKVRPATEH
FKTALFITSSMMLVLLLGAAVVVWKKSRGRVQPAAKAGYEKLADPNKSYSSYKSSYREST
SFEEDQVIEYRDRDYDEDDDDDIVYMGQDGTVYRKFKYGLLDDDDIDELEYDDESYSYYQ
Download sequence
Identical sequences Q92824
ENSP00000446280 gi|299523015|ref|NP_001177411.1| NP_001177411.1.87134 NP_001177411.1.92137 ENSP00000446280 ENSP00000446280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]