SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|299890879|ref|NP_001177768.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|299890879|ref|NP_001177768.1|
Domain Number 1 Region: 91-123
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000129
Family GLA-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|299890879|ref|NP_001177768.1|
Sequence length 128
Comment matrix Gla protein isoform 1 precursor [Homo sapiens]
Sequence
MKSLILLAILAALAVVTLCYGEWQKEENFGFDIVSVLSLNWHRAQESHESMESYELNPFI
NRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRY
FRKRRGTK
Download sequence
Identical sequences ENSP00000228938 gi|299890879|ref|NP_001177768.1| ENSP00000445907 NP_001177768.1.87134 NP_001177768.1.92137 ENSP00000228938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]