SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30089999|ref|NP_829888.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30089999|ref|NP_829888.1|
Domain Number 1 Region: 122-173,207-386
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.78e-61
Family Actin/HSP70 0.0000132
Further Details:      
 
Domain Number 2 Region: 24-128
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.23e-29
Family Actin/HSP70 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30089999|ref|NP_829888.1|
Sequence length 387
Comment actin-like protein 6A isoform 2 [Homo sapiens]
Sequence
MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAI
LDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFAN
GRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYM
IASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQM
PTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRP
GLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILAS
LGTFQQMWISKQEYEEGGKQCVERKCP
Download sequence
Identical sequences A0A2I3SKV1 A0A2K5YXC7 A0A2K6BUM0 F7FQX1 H2PC34
ENSPPYP00000016016 ENSP00000376430 ENSP00000394014 ENSCJAP00000024094 ENSPPYP00000016016 ENSCJAP00000024094 NP_001258600.1.37143 NP_817126.1.87134 NP_817126.1.92137 NP_829888.1.87134 NP_829888.1.92137 XP_007970222.1.81039 XP_008979504.1.60252 XP_011753439.1.29376 XP_011835773.1.47321 XP_011835774.1.47321 XP_011941640.1.92194 XP_011941641.1.92194 XP_014987034.1.72884 XP_014987035.1.72884 XP_014987036.1.72884 XP_016795469.1.37143 XP_017361796.1.71028 XP_017361797.1.71028 XP_017732634.1.44346 XP_017732642.1.44346 XP_017820190.1.60252 ENSP00000376430 ENSP00000394014 gi|30089997|ref|NP_817126.1| gi|30089999|ref|NP_829888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]