SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30348954|ref|NP_065825.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30348954|ref|NP_065825.1|
Domain Number 1 Region: 434-781
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.02e-61
Family Ankyrin repeat 0.000029
Further Details:      
 
Domain Number 2 Region: 145-220
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.14e-23
Family Mib/herc2 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 63-137
Classification Level Classification E-value
Superfamily RING/U-box 2.94e-21
Family ZZ domain 0.0053
Further Details:      
 
Domain Number 4 Region: 11-73
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 6.67e-20
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 5 Region: 944-1004
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000442
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  gi|30348954|ref|NP_065825.1|
Domain Number - Region: 815-859
Classification Level Classification E-value
Superfamily RING/U-box 0.00232
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number - Region: 862-907
Classification Level Classification E-value
Superfamily RING/U-box 0.0162
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|30348954|ref|NP_065825.1|
Sequence length 1006
Comment E3 ubiquitin-protein ligase MIB1 [Homo sapiens]
Sequence
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
RCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHL
RHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGN
RNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPS
GNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDIL
KLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNK
GHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNAL
HHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLD
IQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQD
MQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLC
PDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC
SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQC
RAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQ
TMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Download sequence
Identical sequences A0A2J8XGF1 A0A2K5D831 A0A2K5Q6C1 G3RAF1 H2QEB9 Q86YT6 U3EIN9
ENSP00000261537 ENSGGOP00000012422 9606.ENSP00000261537 ENSGGOP00000012422 NP_065825.1.87134 NP_065825.1.92137 XP_003315915.2.37143 XP_004059280.1.27298 XP_008977844.1.60252 XP_012300452.1.9421 XP_017354293.1.71028 ENSP00000261537 gi|30348954|ref|NP_065825.1| ENSP00000261537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]