SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304361760|ref|NP_001182028.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304361760|ref|NP_001182028.1|
Domain Number 1 Region: 2-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.64e-100
Family Ankyrin repeat 0.00000387
Further Details:      
 
Domain Number 2 Region: 333-744
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.06e-82
Family Ankyrin repeat 0.00000672
Further Details:      
 
Domain Number 3 Region: 706-821
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.53e-18
Family Ankyrin repeat 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|304361760|ref|NP_001182028.1|
Sequence length 899
Comment serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A isoform b [Homo sapiens]
Sequence
MVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAA
SSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFT
PLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDC
EDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS
GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCL
FALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAA
YGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLL
DLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLR
LLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGA
VTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADN
HGYTALHWACYNGHETCVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGAS
IVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEM
LVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAA
RNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILATMMPVSSSSPLSS
LTFNAINRYTNTSKTVSFEALPIMRNEPSSYCSFNNIGGEQEYLYTDVDELNDSDSETY
Download sequence
Identical sequences A0A2J8U3Y2
gi|304361757|ref|NP_001182027.1| gi|304361760|ref|NP_001182028.1| ENSP00000373287 NP_001182027.1.87134 NP_001182027.1.92137 NP_001182028.1.87134 NP_001182028.1.92137 XP_003265420.1.23891 XP_012364004.1.23891 XP_016861515.1.92137 XP_016861516.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]