SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304376261|ref|NP_001182056.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304376261|ref|NP_001182056.1|
Domain Number 1 Region: 31-130
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.45e-34
Family Forkhead DNA-binding domain 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|304376261|ref|NP_001182056.1|
Sequence length 233
Comment forkhead box L1-like [Homo sapiens]
Sequence
MFDSSQYPYNCFNYDADDYPAGSSDEDKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYD
FIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRSEGHEKGKGNYWTFAGGCESLLDLF
ENGNYRRRRRRRGPKREGPRGPRAGGAQGPSGPSEPPAAQGRLAPDSAGEGAPGREPPAS
PAPPGKEHPRDLKFSIDYILSSPDPFPGLKPPCLAQEGRYPRLENVGLHFWTM
Download sequence
Identical sequences A0A1W2PRP0
gi|304376261|ref|NP_001182056.1| NP_001182056.1.87134 NP_001182056.1.92137 XP_011513358.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]