SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304376272|ref|NP_001182061.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304376272|ref|NP_001182061.1|
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.61e-49
Family Ankyrin repeat 0.000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|304376272|ref|NP_001182061.1|
Sequence length 167
Comment cyclin-dependent kinase inhibitor 2A isoform p16gamma [Homo sapiens]
Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE
LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSEMIGNHLWVCRSRHA
Download sequence
Identical sequences gi|304376272|ref|NP_001182061.1| ENSP00000418915 NP_001182061.1.87134 NP_001182061.1.92137 ENSP00000394932 ENSP00000418915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]