SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304434687|ref|NP_710181.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304434687|ref|NP_710181.2|
Domain Number 1 Region: 11-365
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.02e-103
Family Ankyrin repeat 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|304434687|ref|NP_710181.2|
Sequence length 367
Comment serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B isoform B [Homo sapiens]
Sequence
MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELL
ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAV
KCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWA
AYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGN
TALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVN
IQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLIT
SGADTAK
Download sequence
Identical sequences A0A2J8N4P1
ENSPANP00000008456 ENSP00000387233 gi|304434687|ref|NP_710181.2| ENSP00000387233 NP_710181.2.87134 NP_710181.2.92137 ENSMMUP00000029519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]