SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30520327|ref|NP_849142.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30520327|ref|NP_849142.1|
Domain Number 1 Region: 101-280
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.16e-75
Family F-box associated region, FBA 0.00000985
Further Details:      
 
Domain Number 2 Region: 15-78
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000818
Family F-box domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30520327|ref|NP_849142.1|
Sequence length 283
Comment F-box only protein 27 [Homo sapiens]
Sequence
MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRAL
VDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCG
QEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLD
SGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHV
FSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
Download sequence
Identical sequences A0A2J8SDE9 G3QQ72 K7B043 Q8NI29
ENSP00000292853 ENSP00000437662 NP_849142.1.87134 NP_849142.1.92137 XP_004060748.1.27298 XP_016791378.1.37143 XP_018869880.1.27298 ENSP00000292853 ENSP00000437662 ENSGGOP00000004733 9606.ENSP00000292853 ENSP00000292853 gi|30520327|ref|NP_849142.1| ENSGGOP00000004733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]