SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305410793|ref|NP_001182033.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305410793|ref|NP_001182033.1|
Domain Number 1 Region: 64-214,254-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.94e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000153
Further Details:      
 
Domain Number 2 Region: 326-439
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.97e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000043
Further Details:      
 
Domain Number 3 Region: 212-271
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000179
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|305410793|ref|NP_001182033.1|
Sequence length 440
Comment glutathione reductase, mitochondrial isoform 4 precursor [Homo sapiens]
Sequence
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALL
TPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKT
YSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKA
DFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences ENSP00000438845 NP_001182033.1.87134 NP_001182033.1.92137 ENSP00000438845 gi|305410793|ref|NP_001182033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]