SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307775414|ref|NP_001182728.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307775414|ref|NP_001182728.1|
Domain Number 1 Region: 357-620
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-49
Family YWTD domain 0.0000000000968
Further Details:      
 
Domain Number 2 Region: 242-353,625-670
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000243
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 62-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000117
Family LDL receptor-like module 0.0001
Further Details:      
 
Domain Number 4 Region: 101-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 5 Region: 155-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 6 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 7 Region: 193-231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 8 Region: 233-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000798
Family LDL receptor-like module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307775414|ref|NP_001182728.1|
Sequence length 819
Comment low-density lipoprotein receptor isoform 3 precursor [Homo sapiens]
Sequence
MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQ
ETCSPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCI
PQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPD
CKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNK
FKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCP
DGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYL
FFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHG
VSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRA
IVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSK
LHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNL
LAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDG
MLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTT
VEIVTMSHQALGDVAGRGNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSI
NFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDVA
Download sequence
Identical sequences ENSP00000440520 gi|307775414|ref|NP_001182728.1| ENSP00000440520 NP_001182728.1.87134 NP_001182728.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]