SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307775420|ref|NP_001182731.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307775420|ref|NP_001182731.1|
Domain Number 1 Region: 277-540
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.0000000000968
Further Details:      
 
Domain Number 2 Region: 162-273,545-590
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000188
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 75-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 4 Region: 26-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 5 Region: 113-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 6 Region: 153-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000746
Family LDL receptor-like module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307775420|ref|NP_001182731.1|
Sequence length 739
Comment low-density lipoprotein receptor isoform 5 precursor [Homo sapiens]
Sequence
MGPWGWKLRWTVALLLAAAGTAVGDRCERNDFQCNSSTCIPQLWACDNDPDCEDGSDEWP
QRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEF
QCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARD
CRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDP
DTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTS
LIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAV
DWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAK
IKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILED
EKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQP
RGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVAT
QETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNE
KKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHN
QDGYSYPSRQMVSLEDDVA
Download sequence
Identical sequences gi|307775420|ref|NP_001182731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]