SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307775422|ref|NP_001182732.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307775422|ref|NP_001182732.1|
Domain Number 1 Region: 271-534
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-49
Family YWTD domain 0.0000000000968
Further Details:      
 
Domain Number 2 Region: 26-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000111
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 3 Region: 62-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 4 Region: 103-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 5 Region: 156-266
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000659
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307775422|ref|NP_001182732.1|
Sequence length 682
Comment low-density lipoprotein receptor isoform 6 precursor [Homo sapiens]
Sequence
MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQ
ETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPVATCRPDEFQCSDGN
CIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSD
EPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQL
CVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLR
NVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSN
IYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGL
NGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAH
PFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPREAEAA
VATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGR
GNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHI
CHNQDGYSYPSRQMVSLEDDVA
Download sequence
Identical sequences ENSP00000437639 ENSP00000437639 gi|307775422|ref|NP_001182732.1| NP_001182732.1.87134 NP_001182732.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]