SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|309747071|ref|NP_001184254.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|309747071|ref|NP_001184254.1|
Domain Number 1 Region: 347-449
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 158-212,239-254,282-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 76-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 555-718
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000000188
Family Tetraviridae-like VP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|309747071|ref|NP_001184254.1|
Sequence length 773
Comment aryl hydrocarbon receptor nuclear translocator isoform 4 [Homo sapiens]
Sequence
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMA
VSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTP
VLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRM
CMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAW
PPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTF
VDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQE
WLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMG
SGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDP
RFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPS
ASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQVATQATAKTRTSQFGVGSFQTPSSF
SSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHH
RSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
Download sequence
Identical sequences NP_001184254.1.87134 NP_001184254.1.92137 gi|309747071|ref|NP_001184254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]