SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311771764|ref|NP_001185747.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311771764|ref|NP_001185747.1|
Domain Number 1 Region: 26-130
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.25e-24
Family Canonical RBD 0.01
Further Details:      
 
Domain Number 2 Region: 223-326
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.03e-22
Family Canonical RBD 0.0000256
Further Details:      
 
Domain Number 3 Region: 136-223
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.33e-19
Family Canonical RBD 0.000012
Further Details:      
 
Domain Number 4 Region: 442-514
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000728
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311771764|ref|NP_001185747.1|
Sequence length 586
Comment APOBEC1 complementation factor isoform 1 [Homo sapiens]
Sequence
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFI
GKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE
IRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRG
FAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLML
STSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL
AKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQTYAAIPSLH
FPATKGHLSNRAIIRAPSVRGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPG
MELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPAL
ASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAV
PNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF
Download sequence
Identical sequences A0A024QZJ5
gi|20357572|ref|NP_055391.2| gi|311771764|ref|NP_001185747.1| ENSP00000282641 ENSP00000363109 ENSP00000363113 ENSP00000363109 ENSP00000363113 NP_001185747.1.87134 NP_001185747.1.92137 NP_055391.2.87134 NP_055391.2.92137 XP_016871649.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]