SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311893305|ref|NP_001185780.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311893305|ref|NP_001185780.1|
Domain Number 1 Region: 78-167
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-38
Family Forkhead DNA-binding domain 0.0000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311893305|ref|NP_001185780.1|
Sequence length 622
Comment forkhead box protein J3 isoform 1 [Homo sapiens]
Sequence
MGLYGQACPSVTSLRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALL
DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGS
GWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDVLPTRPKKRARSVERASTP
YSIDSDSLGMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASV
NLNSVGSVHSYTPVTSHPESVSQSLTPQQQPQYNLPERDKQLLFSEYNFEDLSASFRSLY
KSVFEQSLSQQGLMNIPSESSQQSHTSCTYQHSPSSTVSTHPHSNQSSLSNSHGSGLNTT
GSNSVAQVSLSHPQMHTQPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQLQSPHPQHPSP
HQHIQHHPNHQHQTLTHQAPPPPQQVSCNSGVSNDWYATLDMLKESCRIASSVNWSDVDL
SQFQGLMESMRQADLKNWSLDQVQFADLCSSLNQFFTQTGLIHSQSNVQQNVCHGAMHPT
KPSQHIGTGNLYIDSRQNLPPSVMPPPGYPHIPQALSTPGTTMAGHHRAMNQQHMMPSQA
FQMRRSLPPDDIQDDFDWDSIV
Download sequence
Identical sequences Q9UPW0
ENSP00000354620 ENSP00000361653 ENSP00000361654 ENSP00000439044 ENSP00000354620 ENSP00000361653 ENSP00000361654 ENSP00000439044 ENSP00000354449 gi|311893303|ref|NP_001185779.1| gi|311893305|ref|NP_001185780.1| gi|50345831|ref|NP_055762.3| NP_001185779.1.87134 NP_001185779.1.92137 NP_001185780.1.87134 NP_001185780.1.92137 NP_055762.3.87134 NP_055762.3.92137 XP_011539328.1.92137 9606.ENSP00000354620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]