SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312176431|ref|NP_001185907.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312176431|ref|NP_001185907.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.1e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312176431|ref|NP_001185907.1|
Sequence length 399
Comment stromal membrane-associated protein 2 isoform 3 [Homo sapiens]
Sequence
MIFKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKAN
RLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSEPVPE
KKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKD
LDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILS
LYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMV
APMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMT
QQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK
Download sequence
Identical sequences A0A2I2ZTZ8 H2PYS0
ENSP00000361793 ENSP00000361793 NP_001185907.1.87134 NP_001185907.1.92137 gi|312176431|ref|NP_001185907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]