SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312176435|ref|NP_001185909.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|312176435|ref|NP_001185909.1|
Domain Number - Region: 1-45
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000146
Family Pyk2-associated protein beta ARF-GAP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312176435|ref|NP_001185909.1|
Sequence length 349
Comment stromal membrane-associated protein 2 isoform 4 [Homo sapiens]
Sequence
MQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDK
WKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIAN
SKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGK
KQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGM
VAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQ
QLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK
Download sequence
Identical sequences A0A2J8LYX4
ENSP00000442835 ENSP00000442835 gi|312176435|ref|NP_001185909.1| NP_001185909.1.87134 NP_001185909.1.92137 XP_016815357.1.37143 XP_018871814.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]