SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|31317224|ref|NP_005702.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31317224|ref|NP_005702.3|
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.47e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000393
Further Details:      
 
Domain Number 3 Region: 76-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000939
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31317224|ref|NP_005702.3|
Sequence length 480
Comment EGF-like repeat and discoidin I-like domain-containing protein 3 precursor [Homo sapiens]
Sequence
MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS
SVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
NECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences O43854
9606.ENSP00000296591 ENSP00000296591 gi|31317224|ref|NP_005702.3| ENSP00000296591 NP_005702.3.87134 NP_005702.3.92137 ENSP00000296591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]