SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|31541941|ref|NP_055093.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31541941|ref|NP_055093.2|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.21e-52
Family Actin/HSP70 0.0000305
Further Details:      
 
Domain Number 2 Region: 195-383
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.02e-50
Family Actin/HSP70 0.0000259
Further Details:      
 
Domain Number 3 Region: 386-495,573-625
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.22e-26
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0097
Further Details:      
 
Domain Number 4 Region: 619-701
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 2.71e-17
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0079
Further Details:      
 
Domain Number 5 Region: 707-796
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000000863
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31541941|ref|NP_055093.2|
Sequence length 839
Comment heat shock 70 kDa protein 4L [Homo sapiens]
Sequence
MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNV
RNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGM
LLAKLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALA
YGIYKQDLPPLDEKPRNVVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLGGRNFDEAL
VDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSK
MNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSIEIVGGATRIPAVKEQITKFFLK
DISTTLNADEAVARGCALQCAILSPAFKVREFSITDLVPYSITLRWKTSFEDGSGECEVF
CKNHPAPFSKVITFHKKEPFELEAFYTNLHEVPYPDARIGSFTIQNVFPQSDGDSSKVKV
KVRVNIHGIFSVASASVIEKQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKC
HAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY
IENEGKMIMQDKLEKERNDAKNAVEEYVYDFRDRLGTVYEKFITPEDLSKLSAVLEDTEN
WLYEDGEDQPKQVYVDKLQELKKYGQPIQMKYMEHEERPKALNDLGKKIQLVMKVIEAYR
NKDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEIVAKSKELDN
FCNPIIYKPKPKAEVPEDKPKANSEHNGPMDGQSGTETKSDSTKDSSQHTKSSGEMEVD
Download sequence
Identical sequences A0A140VKE7 O95757
ENSP00000296464 ENSP00000422482 gi|31541941|ref|NP_055093.2| 9606.ENSP00000296464 NP_055093.2.87134 NP_055093.2.92137 ENSP00000296464 ENSP00000422482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]