SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|31543093|ref|NP_612351.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31543093|ref|NP_612351.2|
Domain Number 1 Region: 51-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.78e-98
Family Glycosyl hydrolases family 35 catalytic domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 484-620
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.1e-27
Family Beta-galactosidase LacA, domains 4 and 5 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31543093|ref|NP_612351.2|
Sequence length 636
Comment beta-galactosidase-1-like protein 2 precursor [Homo sapiens]
Sequence
MTTWSLRRRPARTLGLLLLVVLGFLVLRRLDWSTLVPLRLRHRQLGLQAKGWNFMLEDST
FWIFGGSIHYFRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAF
VLMAAEIGLWVILRPGPYICSEMDLGGLPSWLLQDPGMRLRTTYKGFTEAVDLYFDHLMS
RVVPLQYKRGGPIIAVQVENEYGSYNKDPAYMPYVKKALEDRGIVELLLTSDNKDGLSKG
IVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLK
TVSAIVDAGSSINLYMFHGGTNFGFMNGAMHFHDYKSDVTSYDYDAVLTEAGDYTAKYMK
LRDFFGSISGIPLPPPPDLLPKMPYEPLTPVLYLSLWDALKYLGEPIKSEKPINMENLPV
NGGNGQSFGYILYETSITSSGILSGHVHDRGQVFVNTVSIGFLDYKTTKIAVPLIQGYTV
LRILVENRGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSS
LPETPTLPAFFLGSLSISSTPCDTFLKLEGWEKGVVFINGQNLGRYWNIGPQKTLYLPGP
WLSSGINQVIVFEETMAGPALQFTETPHLGRNQYIK
Download sequence
Identical sequences A0A024R3N9 Q8IW92
NP_612351.2.87134 NP_612351.2.92137 XP_006719000.1.92137 9606.ENSP00000344659 ENSP00000344659 ENSP00000344659 ENSP00000444628 gi|31543093|ref|NP_612351.2| ENSP00000344659 ENSP00000374531 ENSP00000444628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]