SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|31543983|ref|NP_115765.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31543983|ref|NP_115765.2|
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.1e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31543983|ref|NP_115765.2|
Sequence length 521
Comment ADP-ribosylation factor GTPase-activating protein 2 isoform 1 [Homo sapiens]
Sequence
MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPS
TESSGLAQPEHGPNTDLLGTSPKASLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQS
FSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKR
EQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKD
NPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSL
GNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
Download sequence
Identical sequences G3QZQ1 Q8N6H7
NP_115765.2.87134 NP_115765.2.92137 XP_004051085.1.27298 9606.ENSP00000327309 ENSP00000434442 ENSP00000434442 ENSGGOP00000008367 ENSGGOP00000008367 gi|31543983|ref|NP_115765.2| ENSP00000389264 GO.34890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]