SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315570273|ref|NP_001186822.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315570273|ref|NP_001186822.1|
Domain Number 1 Region: 105-333
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.05e-99
Family Actin/HSP70 0.00000000106
Further Details:      
 
Domain Number 2 Region: 5-111
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.63e-44
Family Actin/HSP70 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315570273|ref|NP_001186822.1|
Sequence length 333
Comment actin, gamma-enteric smooth muscle isoform 2 precursor [Homo sapiens]
Sequence
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQIWHHSFYNELRVAPEEHP
TLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHN
VPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALD
FENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSI
MKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIG
GSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
Download sequence
Identical sequences A0A1S2ZGG8 A0A1U7U9J7 A0A2I3LQC5 A0A2I3RDW8 A0A2J8XBD6 A0A2K5F8V1 A0A2K5KDX6 A0A2K5P7T4 A0A2K5QAE9 A0A2K5W8N4 A0A2K6A7T7 A0A2K6E5F4 A0A2K6GEN7 A0A2K6LPG1 A0A2K6U9P9 F6PLA9 F7HNV8 G1QHI9 G3QN21
gi|315570273|ref|NP_001186822.1| ENSP00000386929 NP_001186822.1.87134 NP_001186822.1.92137 XP_003268724.1.23891 XP_003810407.1.60992 XP_004277132.1.21590 XP_004369250.1.4749 XP_004398761.1.74151 XP_004590729.1.84141 XP_004634155.1.9945 XP_004696152.1.18182 XP_005686410.1.57651 XP_005897702.1.15283 XP_005962712.1.78601 XP_006880917.1.29581 XP_007067506.1.26238 XP_007120148.1.24612 XP_007459450.1.90284 XP_007519008.1.11023 XP_007950813.1.48129 XP_008062576.1.4292 XP_008145658.1.99482 XP_008498955.1.100939 XP_010002225.1.85724 XP_011801428.1.43180 XP_011836090.1.47321 XP_021047427.1.100879 ENSCJAP00000033022 ENSP00000386929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]