SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|31563382|ref|NP_037389.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31563382|ref|NP_037389.4|
Domain Number 1 Region: 152-466
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-93
Family Protein kinases, catalytic subunit 0.0000000565
Further Details:      
 
Domain Number 2 Region: 14-122
Classification Level Classification E-value
Superfamily PX domain 1.09e-30
Family PX domain 0.000000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31563382|ref|NP_037389.4|
Sequence length 496
Comment serine/threonine-protein kinase Sgk3 isoform 1 [Homo sapiens]
Sequence
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNT
LKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
SPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAK
RKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVL
DFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHV
VLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP
FYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD
AFVGFSYAPPSEDLFL
Download sequence
Identical sequences A0A024R807 A0A2J8UR60 M3ZA25 Q5R7A7 Q96BR1
9600.ENSPPYP00000020918 9606.ENSP00000262211 ENSP00000262211 NP_001028750.1.87134 NP_001028750.1.92137 NP_001127544.1.23681 NP_001191102.1.87134 NP_001191102.1.92137 NP_037389.4.87134 NP_037389.4.92137 XP_003274839.1.23891 XP_003831405.1.60992 XP_008954969.1.60992 XP_012351573.1.23891 ENSP00000331816 ENSP00000379842 ENSP00000429022 ENSP00000430256 ENSP00000430463 ENSP00000331816 ENSP00000379842 ENSP00000429022 ENSP00000430256 ENSP00000430463 ENSNLEP00000013142 ENSNLEP00000023562 gi|31563382|ref|NP_037389.4| gi|323510643|ref|NP_001191102.1| gi|75813626|ref|NP_001028750.1| ENSNLEP00000013142 HR3122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]