SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|31982881|ref|NP_078968.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31982881|ref|NP_078968.3|
Domain Number 1 Region: 255-383
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.32e-39
Family Cap-Gly domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 470-599
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.84e-38
Family Cap-Gly domain 0.0000591
Further Details:      
 
Domain Number 3 Region: 601-693
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.88e-29
Family Cap-Gly domain 0.0000104
Further Details:      
 
Domain Number 4 Region: 90-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.59e-19
Family Ankyrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|31982881|ref|NP_078968.3|
Sequence length 705
Comment CAP-Gly domain-containing linker protein 4 [Homo sapiens]
Sequence
MTIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL
FDPKTSVSELFAILRQWVPQVQQNIDIIGNEILKRGCNVNDRDGLTDMTLLHYTCKSGAH
GIGDVETAVKFATQLIDLGADISLRSRWTNMNALHYAAYFDVPELIRVILKTSKPKDVDA
TCSDFNFGTALHIAAYNLCAGAVKCLLEQGANPAFRNDKGQIPADVVPDPVDMPLEMADA
AATAKEIKQMLLDAVPLSCNISKAMLPNYDHVTGKAMLTSLGLKLGDRVVIAGQKVGTLR
FCGTTEFASGQWAGIELDEPEGKNNGSVGKVQYFKCAPKYGIFAPLSKISKAKGRRKNIT
HTPSTKAAVPLIRSQKIDVAHVTSKVNTGLMTSKKDSASESTLSLPPGEELKTVTEKDVA
LLGSVSSCSSTSSLEHRQSYPKKQNAISSNKKTMSKSPSLSSRASAGLNSSATSTANNSR
CEGELRLGERVLVVGQRLGTIRFFGTTNFAPGYWYGIELEKPHGKNDGSVGGVQYFSCSP
RYGIFAPPSRVQRVTDSLDTLSEISSNKQNHSYPGFRRSFSTTSASSQKEINRRNAFSKS
KAALRRSWSSTPTAGGIEGSVKLHEGSQVLLTSSNEMGTVRYVGPTDFASGIWLGLELRS
AKGKNDGSVGDKRYFTCKPNHGVLVRPSRVTYRGINGSKLVDENC
Download sequence
Identical sequences Q8N3C7
ENSP00000327009 ENSP00000385594 9606.ENSP00000327009 NP_001274456.1.87134 NP_001274456.1.92137 NP_078968.3.87134 NP_078968.3.92137 XP_005264619.1.92137 XP_005264620.1.92137 XP_006712167.1.92137 XP_011531411.1.92137 XP_016860447.1.92137 ENSP00000327009 ENSP00000385594 gi|31982881|ref|NP_078968.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]