SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320118926|ref|NP_001188457.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320118926|ref|NP_001188457.1|
Domain Number 1 Region: 94-440
Classification Level Classification E-value
Superfamily Subtilisin-like 9.95e-82
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 434-580
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-43
Family Proprotein convertase P-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 11-82
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000000148
Family Prohormone convertase 1 pro-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320118926|ref|NP_001188457.1|
Sequence length 619
Comment neuroendocrine convertase 2 isoform 3 [Homo sapiens]
Sequence
MVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKR
RRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQAD
GTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPR
YTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMP
QLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNC
DGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLR
HSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFN
HLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKEN
FVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHT
WGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEEL
EEELDEAVERSLKSILNKN
Download sequence
Identical sequences ENSP00000367131 gi|320118926|ref|NP_001188457.1| NP_001188457.1.87134 NP_001188457.1.92137 ENSP00000367131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]