SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320118928|ref|NP_001188458.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320118928|ref|NP_001188458.1|
Domain Number 1 Region: 78-424
Classification Level Classification E-value
Superfamily Subtilisin-like 9.3e-82
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 418-564
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-43
Family Proprotein convertase P-domain 0.0001
Further Details:      
 
Weak hits

Sequence:  gi|320118928|ref|NP_001188458.1|
Domain Number - Region: 30-56
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00748
Family Prohormone convertase 1 pro-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320118928|ref|NP_001188458.1|
Sequence length 603
Comment neuroendocrine convertase 2 isoform 2 preproprotein [Homo sapiens]
Sequence
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKV
KMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELG
YTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGE
VSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNG
KTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAI
NDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFA
LALEANLGLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKM
AKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENFVRYLEHVQAVITVNA
TRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFV
GSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEELEEELDEAVERSLKSIL
NKN
Download sequence
Identical sequences gi|320118928|ref|NP_001188458.1| ENSP00000437458 NP_001188458.1.87134 NP_001188458.1.92137 ENSP00000437458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]